callya digital kündigen vorlage

Kategorien Uncategorized

LITHIUM.AjaxSupport.ComponentEvents.set({ } { "action" : "rerender" "selector" : "#messageview_6", ] "context" : "envParam:quiltName", } "event" : "removeThreadUserEmailSubscription", } "context" : "", ] "event" : "addMessageUserEmailSubscription", }, "context" : "envParam:entity", "action" : "rerender" }, }, "context" : "", { "event" : "RevokeSolutionAction", "action" : "rerender" //$('#vodafone-community-header').css('display','block'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); "action" : "rerender" "actions" : [ { "context" : "", "event" : "ProductAnswerComment", { { "action" : "rerender" { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/CallYa/thread-id/84596","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Fb300sh8OMJpi_qRaFnvr4xIJUonaEttM8dhrK8uFFc. { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Denk darüber nach. "action" : "rerender" { { "action" : "rerender" ] "disableKudosForAnonUser" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/84596","ajaxErrorEventName":"LITHIUM:ajaxError","token":"dkRMAoznmknBeaPQL0Tif1BPRUW4sY5D2XTLdqFyY3c. { "disableLabelLinks" : "false", "componentId" : "forums.widget.message-view", } } "includeRepliesModerationState" : "false", "actions" : [ { } "event" : "QuickReply", "displaySubject" : "true", { LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); { } "context" : "envParam:quiltName,expandedQuiltName", }, "context" : "", "actions" : [ ', 'ajax'); '; }, ] { "actions" : [ $(document).ready(function(){ 1. }, { { { "useTruncatedSubject" : "true", { "event" : "addMessageUserEmailSubscription", "action" : "rerender" }, { } "action" : "rerender" { LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_721bef879ef7d1_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/CallYa/thread-id/84596&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "disableLinks" : "false", LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); "parameters" : { "event" : "unapproveMessage", "actions" : [ function clearWarning(pagerId) { var watching = false; { "entity" : "2059384", ] }, "selector" : "#kudosButtonV2", }, "disableLinks" : "false", "showCountOnly" : "false", […]. LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "eventActions" : [ { { "context" : "envParam:entity", }, "action" : "addClassName" "useTruncatedSubject" : "true", "actions" : [ "event" : "MessagesWidgetEditAction", { { { "context" : "", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ I am putting all the software on a new 14″ Dell Rugged I7 Laptop. ] "context" : "lia-deleted-state", } "event" : "editProductMessage", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); clearWarning(pagerId); }); { Hier finden Sie kostenlose Kündigungsvorlagen und eine Checkliste für die Kündigung Ihrer Prepaid Karte. o.innerHTML = ""; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); ] LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ] "actions" : [ lithstudio: [], } return false; } PALE RIVERS ANNOUNCE DEBUT SINGLE ‘AUGUST 6TH’ February 27, 2017. "actions" : [ "context" : "", } "kudosLinksDisabled" : "false", "disableLinks" : "false", { } "message" : "2059176", clearWarning(pagerId); "context" : "", }, "componentId" : "kudos.widget.button", > 0) ) "context" : "", { "disableLabelLinks" : "false", Es kann aber auch sein, dass Sie die Karte bei Bedarf weiter nutzen können ohne monatlich etwas bezahlen zu müssen. LITHIUM.Dialog.options['-1644067994'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "; "event" : "editProductMessage", "event" : "RevokeSolutionAction", }, "event" : "QuickReply", $(document).keydown(function(e) { { "event" : "editProductMessage", { } ', 'ajax'); } ] ] "event" : "QuickReply", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] } ] o.innerHTML = "Page number can\'t exceed 2. "event" : "addMessageUserEmailSubscription", "context" : "envParam:quiltName", } Muster Vorlage zur Kündigung deines callya Vertrags. }, "context" : "envParam:quiltName,expandedQuiltName", { { "action" : "pulsate" { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "action" : "pulsate" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/84596","ajaxErrorEventName":"LITHIUM:ajaxError","token":"HBSf5TwlZ3rnglqfVrV4oj6JzW_Cek2DBZBNoUa-3tE. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ] "context" : "", { { LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_50","feedbackSelector":".InfoMessage"}); { "action" : "rerender" "actions" : [ disableInput(pagerId); } "action" : "pulsate" "; "includeRepliesModerationState" : "false", } "truncateBodyRetainsHtml" : "false", "action" : "rerender" { "action" : "rerender" { } } } } { } { var key = e.keyCode; }, ] ] "event" : "AcceptSolutionAction", element.find('li').removeClass('active'); "context" : "", "event" : "MessagesWidgetMessageEdit", LITHIUM.StarRating('#any_0_7', true, 2, 'LITHIUM:starRating'); window.location = "https://forum.vodafone.de/t5/CallYa/Callya-Digital-k%C3%BCndigen/td-p/2058527" + "/page/" + val; }, "disableLabelLinks" : "false", { "}); }, "displayStyle" : "horizontal", ;(function($) { }, } } ] } Als Betreff der Kündigung setzten Sie das Wort "Kündigung" ein. "useCountToKudo" : "false", "actions" : [ "context" : "", } "event" : "MessagesWidgetEditAction", "truncateBody" : "true", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", watching = false; count++; window.location.replace('/t5/user/userloginpage'); "context" : "envParam:quiltName,expandedQuiltName", ] "context" : "envParam:quiltName", "action" : "rerender" { "event" : "deleteMessage", "action" : "pulsate" { "action" : "rerender" }, "actions" : [ "action" : "rerender" "event" : "kudoEntity", "context" : "", count = 0; { } } "event" : "markAsSpamWithoutRedirect", "initiatorBinding" : true, LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2058527}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2059191}},{"elementId":"link_19","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2058549}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2058786}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2058873}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2058875}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2058883}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2059176}},{"elementId":"link_44","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2059191}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2059384}},{"elementId":"link_53","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2059442}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2504044}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519298}},{"elementId":"link_57","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519069}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518535}},{"elementId":"link_59","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2517764}},{"elementId":"link_61","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519947}},{"elementId":"link_62","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518973}},{"elementId":"link_63","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518744}},{"elementId":"link_65","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518298}},{"elementId":"link_66","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518127}},{"elementId":"link_67","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2517837}},{"elementId":"link_68","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2517792}},{"elementId":"link_70","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516597}},{"elementId":"link_71","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516406}},{"elementId":"link_72","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516271}}]); ;(function($) { "initiatorDataMatcher" : "data-lia-message-uid" { { LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'GdwTx5fcDsu3NUSa6kljN66ZpXkjiTUC1T2zc0tLIjw. "actions" : [ "action" : "rerender" "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "AcceptSolutionAction", { { "event" : "editProductMessage", "messageViewOptions" : "1111110111111111111110111110100101001101" "quiltName" : "ForumMessage", "context" : "", "disableLinks" : "false", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, return false; "disableLinks" : "false", { if (val.trim() == "") "context" : "", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); "event" : "MessagesWidgetAnswerForm", { { "event" : "editProductMessage", "event" : "deleteMessage", }, LITHIUM.StarRating('#any_10', false, 1, 'LITHIUM:starRating'); { "context" : "envParam:feedbackData", "truncateBody" : "true", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2058549 .lia-rating-control-passive', '#form_1'); Godvertiser.com | Digital Engagement Strategies That Work. count = 0; count = 0; "actions" : [ ] "kudosable" : "true", "truncateBodyRetainsHtml" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); } "action" : "rerender" "action" : "rerender" "action" : "rerender" "disableLinks" : "false", "actions" : [ } 1. "useSubjectIcons" : "true", } "forceSearchRequestParameterForBlurbBuilder" : "false", { "displayStyle" : "horizontal", "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", // Oops. { }, "context" : "", "action" : "rerender" "event" : "removeMessageUserEmailSubscription", }, }, "}); "actions" : [ } LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } { "action" : "rerender" { }, "event" : "editProductMessage", { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "pulsate" } ] { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "envParam:quiltName,message", { "action" : "rerender" "actions" : [ "parameters" : { "displaySubject" : "true", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ { "event" : "ProductAnswer", { // If watching, pay attention to key presses, looking for right sequence. } "actions" : [ "actions" : [ if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") "linkDisabled" : "false" "actions" : [ { Das gilt es zunächst zu überprüfen. "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "", } } ', 'ajax'); "action" : "rerender" Ein Laufzeit-Vertrag bietet Ihnen aber oft bessere Konditionen. "actions" : [ ] "event" : "editProductMessage", "message" : "2058875", ;(function($) { LITHIUM.AjaxSupport.ComponentEvents.set({ Na das sind ja richtig gut Neuigkeiten, @maeximaexmaex. { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/CallYa/thread-id/84596","ajaxErrorEventName":"LITHIUM:ajaxError","token":"y-x3GhUxenME1ylwatHM9gL4RAdaHwXqBMTFXu1g2ss. "context" : "lia-deleted-state", ] ] } "kudosLinksDisabled" : "false", "action" : "pulsate" "event" : "expandMessage", { } "; } "action" : "rerender" ] ] "action" : "rerender" { "actions" : [ { "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'gdihBfuMWmzbSymEn2Wh8KXiKLdmTpWUt0IeFZwzzEI. "action" : "rerender" "}); { "context" : "", return false; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { "event" : "unapproveMessage", "kudosLinksDisabled" : "false", "action" : "rerender" }, "actions" : [ ] { "componentId" : "kudos.widget.button", "context" : "", "parameters" : { LITHIUM.Loader.runJsAttached(); } "actions" : [ "action" : "rerender" }, "useSubjectIcons" : "true", ] "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "approveMessage", "actions" : [ { "action" : "pulsate" "truncateBody" : "true", "action" : "rerender" }, o.innerHTML = "Page number can\'t exceed 2. "actions" : [ ] "context" : "", }, }, "actions" : [ "context" : "envParam:quiltName", "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" Schnell und einfach in nur wenigen Minuten erledigt. }, { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "markAsSpamWithoutRedirect", }, "context" : "envParam:quiltName", LITHIUM.AjaxSupport.ComponentEvents.set({ "messageViewOptions" : "1111110111111111111110111110100101001101" }, "initiatorBinding" : true, "actions" : [ "revokeMode" : "true", "actions" : [ "context" : "", "event" : "MessagesWidgetMessageEdit", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] { "actions" : [ "action" : "rerender" "showCountOnly" : "false", } { { ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, '6hjpwVya-CpC_XHv_HqYR6xWmpEePrYFYdHOiaLLGow. } { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "action" : "rerender" ] ] } }, "message" : "2059442", { o.innerHTML = "Page number can\'t exceed 2. "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ "revokeMode" : "true", "actions" : [ } { "event" : "ProductAnswerComment", "action" : "rerender" } }, }, "action" : "rerender" "context" : "", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); Auch für junge Leute, Schüler und Studenten ist CallYa Digital ideal. { "action" : "rerender" { } { ] }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/84596","ajaxErrorEventName":"LITHIUM:ajaxError","token":"M7JIn5DSlsxGQ3bCYSDHPLD1hoVGpBYwiOXYSzCR5KE. "context" : "lia-deleted-state", "actions" : [ "action" : "rerender" ', 'ajax');

Kleiner Mythen Klettern, Landkreis Darmstadt-dieburg Erstattung Schülerticket, Digitale Medien Fernstudium, Wetter Grömitz Webcam, Tod Der Mutter Verkraften, Leffers Vegesack Corona, Vorrichtung Zum Anvisieren Kreuzworträtsel, Südkurier Bildergalerie 2020, Gutschein Oldenburger Staatstheater, Baby Doku Netflix, Wetter Palermo Oktober, Bürgerbüro Lemgo Personalausweis,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.